PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g17110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 220aa    MW: 23809.4 Da    PI: 6.9697
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g17110.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-42661651100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+l
  Vradi08g17110.1  66 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQL 159
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Vradi08g17110.1 160 AKAQAE 165
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.96465166IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-4366163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MYYKLKTTTT TASSPIPIHL PTMLSNSPPS SSSSPPSHSP TPFPSPSQGS PAPAPPSPPP  60
PVVVSPCAAC KILRRRCVEK CVLAPYFPPT DPLKFTIAHR VFGASNIIKF LQELPESQRA  120
DAVSSMVYEA NARIRDPVYG CAGAICQLQK QVSELQAQLA KAQAEVVNMQ CQQANLVALI  180
CMEMSESQEQ HMVQPQAHID MSCFIEDNSF GSAWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991130.0BT099113.1 Soybean clone JCVI-FLGm-13B15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512819.11e-160PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A151U6371e-120A0A151U637_CAJCA; LOB domain-containing protein 1
STRINGGLYMA20G31780.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-65LOB domain-containing protein 1